SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031578 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031578
Domain Number 1 Region: 241-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 548-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.75e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 184-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 4 Region: 493-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-22
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 353-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.81e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 437-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 8 Region: 1-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.15e-20
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 9 Region: 650-702
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.78e-16
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 10 Region: 590-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000175
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 11 Region: 153-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000171
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 12 Region: 399-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000159
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031578   Gene: ENSMMUG00000021472   Transcript: ENSMMUT00000030223
Sequence length 707
Comment pep:known chromosome:MMUL_1:19:50530948:50544514:1 gene:ENSMMUG00000021472 transcript:ENSMMUT00000030223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMFKEAMTFKDVAVVFTEEELGLLDLAQRKLYQDVMLENFRNLLSVGHQAFHRDTFHFL
REEKIWMMKTATQREGDSGDKIQTEMETISEAGTDQEWSCQQIWEKIASDLTRSQDLVIN
SSQFSREGDFPSQSEAGLSVIHTRQKSSQSNGYKQSFSDVSIFDFHQQLHSGEMSHTCDE
CGKSFCYISALRIHQRVHLGEKRYKCDVCGKEFSQSSRLQTHQRVHTGEKPFKCVECGKG
FSRRSALNVHHKLHTGEKPYNCEECGKAFIHDSQLQEHQRIHTGEKPFKCDICGKSFCGR
SRLNRHSMVHTGEKPFQCDTCGRSFRQRSALNSHLMIHTGEKPYKCEECGKGFICRRDLY
THHMVHTGEKPYNCKDCGKNFRWASCLLKHQRVHSGEKPFKCEECGKGFYTNSQCYSHQR
SHSGEKPYKCVECGKGYKRRLDLDFHQRVHTGEKLYNCKECGKSFSRAPCLLKHERLHSG
EKPFQCEECGKRFTQNSHLHSHQRVHTGEKPYKCEKCGKGYNSKFNLDMHQKVHTGERPY
NCKECGKSFGWASCLLKHQRLHSGEKPFKCEECGKRFTQNSQLHSHQRVHTGEKPYKCDE
CGKGFRWSSTRLTHQRRHSRETPLKCEEHGKNIVRNSFSKVLEKVHSVQKPYKCEDCGKG
YNRRLNLEVHQRVHVGEKTWKCQECDMCFSRASSLQLHQNVHVGEKP
Download sequence
Identical sequences A0A1D5QIF7
ENSMMUP00000031578 9544.ENSMMUP00000031578 ENSMMUP00000028284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]