SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031639 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031639
Domain Number 1 Region: 558-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 670-727
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 502-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.84e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 614-671
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 362-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 418-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 250-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 23-79
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-22
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 9 Region: 166-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 10 Region: 712-764
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.13e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 11 Region: 292-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.72e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 12 Region: 128-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000188
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 465-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000964
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 14 Region: 214-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000126
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000031639
Domain Number - Region: 95-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000326
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031639   Gene: ENSMMUG00000000107   Transcript: ENSMMUT00000038539
Sequence length 769
Comment pep:known chromosome:MMUL_1:19:43562812:43587524:-1 gene:ENSMMUG00000000107 transcript:ENSMMUT00000038539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAHWTSSQKSSALAPEDHGSSCEGSVSFRDVAIDFSREEWRHLDPSQRNLYRDVMLETY
SHLLSVGYQVPEAEVVMLEQGKEPWALQGERPRQSCPGEKLWDHNQCRKILTYKQVSSRP
QKVYPGEKPYECAEFEKIFTQKSQLKVHLKVLAGEKLYVCIECGKAFVQKPEFIIHQKTH
MREKPFKCNECGKSFFQVSSLFRHQRIHTGEKLYECSQCGKGFSYNSDLSIHEKIHTGER
HHECTDCGKAFTQKSTLKMHQKIHTGERSYICIECGQAFIQKTHLIAHRRIHTGEKPYEC
SNCGKSFISKSQLQVHQRVHTRVKPYICTEYGKVFSNNSNLITHKKVQIREKSSICTECG
KAFTYRSELIIHQRIHTGEKPYECSDCGKAFTQKSALTVHQRIHTGEKSYVCMKCGLAFI
QKAHLIAHQIIHTGEKPYKCGHCGKLFTSKSQLHVHKRIHTGEKPYMCNKCGKAFTNRSN
LITHQKTHTGEKSYICSKCGKAFTQRSDLITHQRIHTGEKPYECSTCGKAFTQKSHLNIH
QKIHTGERQYECHECGKAFNQKSILIVHQKIHTGEKPYVCTECGRAFIRKSNFITHQRIH
TGEKPYECSDCGKSFTSKSQLLVHQPIHTGEKPYVCAECGKAFSGRSNLSKHQKTHTGEK
PYICSECGKTFRQKSELITHHRIHTGEKPYECSDCGKSFTKKSQLQVHQRIHTGEKPYVC
AECGKAFTDRSNLNKHQTTHTGDKPYKCGICGKGFVQKSVFSVHQSNHA
Download sequence
Identical sequences F6XFM0
9544.ENSMMUP00000031639 XP_002801244.1.72884 XP_014979067.1.72884 XP_014979068.1.72884 XP_014979069.1.72884 ENSMMUP00000031639 ENSMMUP00000000142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]