SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031641 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031641
Domain Number 1 Region: 314-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.51e-26
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 482-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.24e-25
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 426-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.35e-24
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.55e-24
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.31e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 524-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 220-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-16
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 1-31
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000102
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 
Domain Number 9 Region: 159-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000245
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031641   Gene: ENSMMUG00000022794   Transcript: ENSMMUT00000038542
Sequence length 592
Comment pep:known_by_projection chromosome:MMUL_1:19:43197023:43212851:1 gene:ENSMMUG00000022794 transcript:ENSMMUT00000038542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVMLENYCHLISVGCHMTKPDVILKLERGEEPWTSFSGHTCLEENWKAEDFLLKFKEHQ
EKYSRSVVSINHKKLVKEKGNIYEKTFTLGKNPVNSKNLPPEYDTHGRILKNVSELIISN
LNPARKRLSEYNGYGKSFLSTKQETTHPEVKSHNQSDRAFSHNEVLMQYQKTETPAQSFG
YNDCEKSFLKRGGLMTHNRPYRGENPSVYNKKRRVTNIEKKHTCNECGKSFCRKSVLILH
QGIHSEEKPYQCHQCGNAFRRKSYLIDHQRTHTGEKPFVCNECGKSFRLKTALTDHQRTH
TGEKSYECLQCRNAFRLKSHLIRHQRTHTGEKPYECNDCGKSFRQKTTLSLHQRIHTGEK
PYICKECGKSFHQKANLTVHQRTHTGEKPYICNECGKSFSQKTTLALHEKTHNEEKPYIC
SECGKSFRQKTTLVAHQRTHTGEKSYECPHCGKAFRMKSYLIDHHRTHTGEKPYECNECG
KSFSQKTNLNLHQRIHTGEKPYICNECGKSFRQKATLTVHQKIHTGQKSYECPQCGKAFS
RKSYLIHHQRTHTGEKPYKCSECGKCFRQKTNLIVHQRTHTGGADGLTGCLS
Download sequence
Identical sequences ENSMMUP00000031641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]