SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031642 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031642
Domain Number 1 Region: 454-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.37e-26
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 314-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.89e-26
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 510-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.23e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.28e-24
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.64e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 556-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-21
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 220-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.49e-16
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 417-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000656
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 9 Region: 1-31
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000107
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 
Domain Number 10 Region: 159-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000257
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031642   Gene: ENSMMUG00000022794   Transcript: ENSMMUT00000038543
Sequence length 616
Comment pep:known_by_projection chromosome:MMUL_1:19:43195860:43210487:1 gene:ENSMMUG00000022794 transcript:ENSMMUT00000038543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVMLENYCHLISVGCHMTKPDVILKLERGEEPWTSFSGHTCLEENWKAEDFLLKFKEHQ
EKYSRSVVSINHKKLVKEKGNIYEKTFTLGKNPVNSKNLPPEYDTHGRILKNVSELIISN
LNPARKRLSEYNGYGKSFLSTKQETTHPEVKSHNQSDRAFSHNEVLMQYQKTETPAQSFG
YNDCEKSFLKRGGLMTHNRPYRGENPSVYNKKRRVTNIEKKHTCNECGKSFCRKSVLILH
QGIHSEEKPYQCHQCGNAFRRKSYLIDHQRTHTGEKPFVCNECGKSFRLKTALTDHQRTH
TGEKSYECLQCRNAFRLKSHLIRHQRTHTGEKPYECNDCGKSFRQKTTLSLHQRIHTGEK
PYICKECGKSFHQKANLTVHQRTHTGEKPYICNECGKSFSQKTTLALHEKTHNEEKPYIC
SECGKSFRQKTTLVAHQRTHTGEKSYECPHCGKAFRMKSYLIDHHRTHTGEKPYECNECG
KSFSQKTNLNLHQRIHTGEKPYICNECGKSFRQKATLTVHQKIHTGQKSYECPQCGKAFS
RKSYLIHHQRTHTGEKPYKCSECGKCFRQKTNLIVHQRTHTGEKPYVCNECGKSFSYKRN
LIVHQRTHKGENIEMQ
Download sequence
Identical sequences ENSMMUP00000031642 ENSMMUP00000031643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]