SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031698 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031698
Domain Number 1 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 458-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.61e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 402-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.03e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 346-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.26e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 234-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 504-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 2-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-19
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 8 Region: 178-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000202
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 9 Region: 140-189
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000084
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031698   Gene: ENSMMUG00000003689   Transcript: ENSMMUT00000038603
Sequence length 565
Comment pep:known_by_projection chromosome:MMUL_1:19:22799067:22809306:1 gene:ENSMMUG00000003689 transcript:ENSMMUT00000038603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLLTFRDVAVEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGKDNFNTQFLCFSFETES
ASVARLECICKVMLMCSHFAQEFWPEQNIKDSFEKVALRRYEKCGNDNLQLKGCKSVDEC
KVYKGGYNGLNQCLPTTQSKMFQCDKYVKVFNKLSHSDRHKIKHVENKPFKCKECGKSFC
ILSHLTQRKRNYTKVNFCKCEECEKAFNQSSKFTKHKRIYTCEKLYRCQECDKTFNQFSN
LTEYKKDYTREKPYKCEECGKAFNQSSHLTTHKIIHTGEKPYKCEECGKAFNQFSNLTTH
KKIHTGEQPYICEECGKAFTQSSTLTTHKRIHTGEKPYKCEECGKAFNRSSKLTEHKNIH
TGEQPYKCEECGKAFNRSSNLTEHRKIHTEEKPYKCKECGKAFKHSSALTTHKRIHTGEK
PYKCEECGKAFNRSSKLTEHKKLHTGKKPYKCEECGKAFIQSSKLTEHKKIHSGEIPYKC
EECGKAFKHSSSLTTHKRIHTGEKPYKCEECGKAFSRSSKLTEHKIIHTGEKPYKCERCD
KAFNQSANLTKHKKMHTGEKQNWKV
Download sequence
Identical sequences ENSMMUP00000017281 9544.ENSMMUP00000031698 ENSMMUP00000031698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]