SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031705 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031705
Domain Number 1 Region: 387-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.89e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.22e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 303-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 248-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.44e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 513-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 194-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 2-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.28e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 8 Region: 556-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-19
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 9 Region: 434-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000536
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 10 Region: 350-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000584
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 153-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000117
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031705   Gene: ENSMMUG00000021333   Transcript: ENSMMUT00000038608
Sequence length 612
Comment pep:novel chromosome:MMUL_1:19:21844100:21854631:1 gene:ENSMMUG00000021333 transcript:ENSMMUT00000038608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVFQGPLTFMDVVIKFSPEEWQFLDTAQQNLYRDVMLENYRNLVFLGENNFNTQLFCFF
FEECVLYLYDAVQHHYNNGKKFHFYDLDVIKSYLSHKLWHIFSVVYSHFAQDLWPEQGIK
DSFPKVILRRYGKYGHDNLQLRKGCESVATRNKIFQCDKYVKVFHKFSSSNSHNIRHTGN
NSFKCKECGKSCCMLSHLTQHERTHTRVNRYKCKECGKAFSMPTSLNNHKRIHTGEKPYK
CEECGKAYNWPSIISKHKRIHTGKKPYKCEECGKAFSESSSLNNHKRIHTGEKPYTCEEC
GKSYNWPSIISKHKRIHTGKKPYKCEECGKAFSESSSLNNHKRIHTGEKPYKCEECGKAY
NWPSTISKHKRIHTGKKPYKCEECGKAFSESSNLNSHKRIHTGEKPYKCEECGKAFSESS
SLNNHKRIHTGEKPYKCEECGKAFKIRAYLTTHNRIHTGEKPYKCKECGKAFSGSSSLNN
HKIIHSGEKPYKCEECGKAFKIRAYLTTHNRIHTGEKPYKCEECGKAFNRSSSLTIHNRI
HTVEKPYKCKQCGKGFSQSSSLTKHKIIHTTEKPYKCEECGKAFNKSSILNIHKMIHTKE
KPQNYKCEECGK
Download sequence
Identical sequences ENSMMUP00000031705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]