SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031806 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031806
Domain Number 1 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 402-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-22
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 3 Region: 621-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 733-790
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.68e-22
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 5 Region: 565-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-21
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 6 Region: 1-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-21
Family KRAB domain (Kruppel-associated box) 0.00065
Further Details:      
 
Domain Number 7 Region: 677-734
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.9e-21
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 8 Region: 447-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.53e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 9 Region: 510-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-18
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 10 Region: 289-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.77e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-17
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 12 Region: 349-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.59e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 13 Region: 139-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000349
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031806   Gene: ENSMMUG00000013571   Transcript: ENSMMUT00000038729
Sequence length 832
Comment pep:known chromosome:MMUL_1:19:11839008:11843669:1 gene:ENSMMUG00000013571 transcript:ENSMMUT00000038729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQDSVAFEDVAVNFTQEEWSLLDPSQKNLYREVMQETLRNLASIGKNIQKFSICKTVNI
QGRKPTLSWIMLKMQVQSLLINIKSLTNKPSIMCFSFFTEVFWERESMKIQKKIIVEKFL
HIRADAAHKPSEYQEYGQKPYKCQQRKKAFRCHPSFQTEEKAHTGEKLYDCKECGKTFIS
RSSIRRHMIMHNGDGPYKCKFCGKACPCLRVCLIHERVHTGEKPYECKQCGKAFSYSNSL
QIHERTHTGEKPYECKECGKAFGSPNSFYEHKRIHTGEKPYECKQCGKAFRWFHSFQIHE
RTHSEEKPYECTKCGKAFKCPSYLCRHEVTHSGKKPYECKQCGKALSYLNFQRHMKMHTR
MRPYKCKTCGKDFDSPSSFLRHYHERTHTGEKPYECKQCGKAFISSTSFRYHERTHTGEK
PYACKQCGKAFRSASHLQMHKRTHTQEKPYECKQCGKAFIFSYHERTHTGEKPYECKQCG
KAFRSASHLQMHERTHTGKQLYESKQCEKTFGSVRNLQIHEKTHTGEKPYKECGKAFNNF
SSFQIHATMTHTGEKPYECKECGKAFNYFSSLHIHKRVHTGEKPYECKDCGKAFGLPGSF
RRHKRAHTGVKPYECKQCGKAFTSSGSFQCHKRIHTGEKPYECKQCGKAFISSTAIRRHE
RTHTGEKPYECKQCGKAFISFSSVRYHERTHTGEKQYECKQCGKAFMSSTAFQYHEKTHT
GEKPYECKQCGKAFISSSSLRYHERTHTGEKPYECKQRGKAFRSATQLQMHRKIHTGEKP
YECKQCGKVYRSASQLRVKGLTLERNPMNISNMGKPSDLCYSLFRILKVISG
Download sequence
Identical sequences 9544.ENSMMUP00000031806 ENSMMUP00000031806 ENSMMUP00000030011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]