SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031807 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031807
Domain Number 1 Region: 271-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 159-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 466-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 3-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-22
Family KRAB domain (Kruppel-associated box) 0.00063
Further Details:      
 
Domain Number 5 Region: 550-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.06e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 410-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-21
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 215-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.28e-21
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 606-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-19
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 9 Region: 355-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-18
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 10 Region: 103-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-18
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 11 Region: 65-117
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000293
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 12 Region: 513-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000679
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031807   Gene: ENSMMUG00000013571   Transcript: ENSMMUT00000038730
Sequence length 687
Comment pep:known chromosome:MMUL_1:19:11839002:11843653:1 gene:ENSMMUG00000013571 transcript:ENSMMUT00000038730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGMFQDSVAFEDVAVNFTQEEWSLLDPSQKNLYREVMQETLRNLASIGYRSKHVNIIKNF
EYGQKPYKCQQRKKAFRCHPSFQTEEKAHTGEKLYDCKECGKTFISRSSIRRHMIMHNGD
GPYKCKFCGKACPCLRVCLIHERVHTGEKPYECKQCGKAFSYSNSLQIHERTHTGEKPYE
CKECGKAFGSPNSFYEHKRIHTGEKPYECKQCGKAFRWFHSFQIHERTHSEEKPYECTKC
GKAFNRSSSFHYHERTHTGEKPYECKQCGKAFISSTSFRYHERTHTGEKPYACKQCGKAF
RSASHLQYHERTHTGEKPYECKQCGKAFRSASHLQMHERTHTGKQLYESKQCEKTFGSVR
NLQIHEKTHTGEKPYKECGKAFNNFSSFQIHATMTHTGEKPYECKECGKAFNYFSSLHIH
KRVHTGEKPYECKDCGKAFGLPGSFRRHKRAHTGVKPYECKQCGKAFTSSGSFQCHKRIH
TGEKPYECKQCGKAFISSTAIRRHERTHTGEKPYECKQCGKAFISFSSVRYHERTHTGEK
QYECKQCGKAFMSSTAFQYHEKTHTGEKPYECKQCGKAFISSSSLRYHERTHTGEKPYEC
KQRGKAFRSATQLQMHRKIHTGEKPYECKQCGKVYRSASQLRVLERTHTGEKPYEYKQYG
KAFRSDFNFHAYILRTFDPDFLFVHNT
Download sequence
Identical sequences ENSMMUP00000031807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]