SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031866 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031866
Domain Number 1 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 15-75
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-25
Family KRAB domain (Kruppel-associated box) 0.00071
Further Details:      
 
Domain Number 3 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.61e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 581-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-18
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 8 Region: 203-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-18
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 9 Region: 446-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000218
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 10 Region: 250-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000722
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000031866
Domain Number - Region: 151-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000714
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031866   Gene: ENSMMUG00000018887   Transcript: ENSMMUT00000038787
Sequence length 642
Comment pep:known chromosome:MMUL_1:19:9184309:9193554:-1 gene:ENSMMUG00000018887 transcript:ENSMMUT00000038787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEERTTVELQKNSIQDSVVFEDVAVDFTQEEWALLDLAQRNLYREVMLENFQNLASLGY
LLHTPHLICQWEQEEDLQTVKRELIQARILGRNCFGFETQLKTNESVAPQDICGEKISNE
QKIVRFKRNDSWFSSLHENQESCGIDDQNKSHERHLRNHMVENIYECCEENQDGQTFSQV
PNLDSLKRNTEVKSYECHECGKAFVDHSSLKNHIKSHTGSKPYQCKECGKAFHFLACFKK
HMKTPTEEKPYECKECTKAFSCSSFFRAHMKIHVGKTNYECKECGKAFSCSSSLTEHKRI
HSGDKPYECKECGKAFSCSSSLSKHKRIHSGDKPYECKECGKAFSSSSHLIIHIRIHTGE
KPYECKECGKAFSESSKLTVHVRTHTGEKPYKCKECGKAYNCPSSLSIHIRKHTGEKPYE
CLECGKAFYLPTSLNTHVKNQSREKPYECKECGKAFSCPSSFRAHVRDHTGKIQYECKEC
GKTFSRSSSLTEHLRTHSGEKPYECKECGKAFISSSHLTVHIRTHTGEKPYECKKCGKAF
IYPSALRIHMRTHTGEKPYECKECGKAFRHSSYLTVHARMHTGEKPFECLECGKAFSCPS
SFRRHVRSHTGEKPYECQECGKAFVCPAYFRRHVKTHTRENI
Download sequence
Identical sequences ENSMMUP00000024851 ENSMMUP00000031866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]