SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032033 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032033
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-46
Family Phosphotyrosine-binding domain (PTB) 0.0000012
Further Details:      
 
Domain Number 2 Region: 292-399
Classification Level Classification E-value
Superfamily SH2 domain 3.77e-28
Family SH2 domain 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032033   Gene: ENSMMUG00000000485   Transcript: ENSMMUT00000038945
Sequence length 411
Comment pep:known_by_projection chromosome:MMUL_1:19:152344:172783:-1 gene:ENSMMUG00000000485 transcript:ENSMMUT00000038945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QYMGCIEVLRSMRSLDFNTRTQVTREAINRLHEAVPGVRGSWKKKAPNKALASVLGKSNL
RFAGMSISIHISTDGLSLSVPATRQVIANHHMPSISFASGGDTDMTDYVAYVAKDPINQR
ACHILECCEGLAQSVISTVGQAFELRFKQYLHSPPKVALPPERRAGYHGEARAASALQPA
AQAYVGSLGGGLLSDGGGSGVRVRAGGLPRSWRTAGLAQPQVHQGVRVRAGGPPRTRSWR
NLRPLKPQPCWKPLENPGQNILTLEAAEREYLGYVGGPGQCGMTAAPLPLEDQWPSPPTR
RAPVAPTEEQLRQEPWYHGRMSRRAAERMLRADGDFLVRDSVTNPGQYVLTGMHAGQPKH
LLLVDPEGVVRTKDVLFESISHLIDHHLQNGQPIVAAESELHLRGVVSREP
Download sequence
Identical sequences ENSMMUP00000032033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]