SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033316 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033316
Domain Number 1 Region: 70-134
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.69e-22
Family SCAN domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033316   Gene: ENSMMUG00000022080   Transcript: ENSMMUT00000040250
Sequence length 146
Comment pep:known chromosome:MMUL_1:7:64686947:64705058:-1 gene:ENSMMUG00000022080 transcript:ENSMMUT00000040250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAAEIPRVTTPLSPLVQVPQVEDRQKEEVTTMILEDDSWVQEAVLQEDGPESEPFPQSA
GKGSSQEEVTKGPQGALSRLRELCRRWLRPEVHTKEQMLTVLPKEIQAWLQEHRPESSEE
AAALVEDLTQTLRDSETASCIHGCPV
Download sequence
Identical sequences F7HNY7
ENSMMUP00000033316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]