SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033422 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033422
Domain Number 1 Region: 182-446
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-76
Family Protein kinases, catalytic subunit 0.00000000027
Further Details:      
 
Domain Number 2 Region: 77-213
Classification Level Classification E-value
Superfamily SH2 domain 8.48e-35
Family SH2 domain 0.00000154
Further Details:      
 
Domain Number 3 Region: 10-102
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-17
Family SH3-domain 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033422   Gene: ENSMMUG00000015267   Transcript: ENSMMUT00000040354
Sequence length 450
Comment pep:known chromosome:MMUL_1:7:53590362:53611431:1 gene:ENSMMUG00000015267 transcript:ENSMMUT00000040354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAIQASWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
NCWHLDAAMRPSFLQLREQLEHIKTHELHL
Download sequence
Identical sequences A0A2K5WPF1 A0A2K6CHS9 F7GRP2
NP_001248565.1.72884 XP_011755288.1.29376 XP_015308572.1.63531 XP_015308573.1.63531 ENSMMUP00000020019 9544.ENSMMUP00000033422 ENSMMUP00000020019 ENSMMUP00000033422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]