SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033535 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033535
Domain Number 1 Region: 81-219
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.21e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.000000352
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.33e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033535   Gene: ENSMMUG00000017137   Transcript: ENSMMUT00000040476
Sequence length 222
Comment pep:known chromosome:MMUL_1:4:52399255:52406724:-1 gene:ENSMMUG00000017137 transcript:ENSMMUT00000040476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKPKLYYYNARGRMESTRWLLAAAGVEFEEKFLESAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGIADLGEMILLLPFCQPEDKDAN
TALIKEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRQPPMNAKSLEESRKIFRF
Download sequence
Identical sequences A0A2K5UYC3 F7FLK3
ENSMMUP00000023142 NP_001182706.1.72884 XP_014991963.1.72884 XP_015304304.1.63531 ENSMMUP00000033535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]