SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033554 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033554
Domain Number 1 Region: 277-355
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000132
Family I set domains 0.024
Further Details:      
 
Domain Number 2 Region: 470-549
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000958
Family V set domains (antibody variable domain-like) 0.028
Further Details:      
 
Domain Number 3 Region: 167-259
Classification Level Classification E-value
Superfamily SEA domain 0.000000103
Family SEA domain 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000033554
Domain Number - Region: 971-1291
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000101
Family Rhodopsin-like 0.034
Further Details:      
 
Domain Number - Region: 380-463
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0338
Family I set domains 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033554   Gene: ENSMMUG00000023002   Transcript: ENSMMUT00000040495
Sequence length 1342
Comment pep:known_by_projection chromosome:MMUL_1:4:46679161:46747149:-1 gene:ENSMMUG00000023002 transcript:ENSMMUT00000040495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSPKRTTLCLMFIVIYSSKATLNWNLESTIHPLSLHEYEPAGEEALRQKRAVATKSPTA
EEYTVNIEISFENASFLDPIKAYLNSLSFPIHGNNTDQILSINVTTVCRPAGNEIWCSCE
TGYGWPRERCLHSLTCQEHDVFLPGHHCSCLKELPTKGPFCLLQEDVTLNMRVRLNVGFQ
EDLMNTSSALYRSYKTDLETAFRKGYGILPGFKGVTVTGFKSGSVVVTYEVKTTAPSLEL
IHKANEQVVQSLNQTYKMDYNSFQALTSNETKFSVTPEIIFEGDTVSLVCENELLSSNVS
WRYEEQQLEIQNSSKFSIYTAVFNNMTSVSKLTIRNITPGDAGEYVCKLILDIFEYEGKK
KIDVMPIQILANEEMKVMCDNNPVSLNCCSQSNVNWSKVEWKQEGKISIPGTPETDIDSS
CSRYTLKADGTQCPSGSSGTTVVYTCEFISAYGARGSANIKVTFISVANLTMTPDTISVS
EGQNFSIKCISDVSNYDEVYWNTSAGIKIYQRFYTTRRYPDGAESVLTVKTSTREWNGTY
HCIFRYKNSYSIATKDVVVHPLPLELNIMVDPLEATVLCSGSHHIKCCIEEDGDYKVTFH
MGSLSLPAEKEVNKKQVCYKHNFSANSVSWWAKLRNWVALKRNMQTSKFDLGLTVFLLSW
ENITCQDPIIGVGEPGKVIQKLCRFSNIPSSPDSPVGGIITYKCVGSQWEEKRNDCIFAP
VNSLLQMAKALIKSPSQDEKLPTYLKDLSISIDKAEHEISSSPGSLGAIINILDLLSTVP
TEVNSETMMHVLSTVNVILGKPVLNTWKVLQQRWTNQSSQLLHSVERFSQALQSGDSPPL
SFFRTNVQMSSMVIKSSHPKTYQQRFVFPHFDLWGNVVIDKSYLEKLQSDSSIVTMAFPT
LQAILAQDIQENNFADSLVMTTTVNHNITMPFRISMTFKNNSPSGGKTQCVFWNFRLADN
TGGWDSNGCYVEEGDGDNVTCICDHLTSFSILMSPDSPDPSSLLGILLDIISYVGVGFSI
LSLAACLVVEAVVWKSVTKNRTSYMRHTCIVNIAASLLIANTWFIVVAAIQGNHYILCKT
ACVAATFFIHFFYLSVFFWMLTLGLMLFYRLVFILHETSRSTQKAIAFCLGYGCPLAISV
ITLGATQPREVYTRKNVCWLNWEDTKALLAFAIPALIIVVVNITITIVVITKILRPSIGD
KPCKQEKSSLFQISKSIGVLTPLLGLTWGFGLTTVFPGTNLVFHIIFAVLNVFQGLFILL
FGCLWDLKVQEALLNKFSLSRWSSQHSKSTSLGSSTPVFSMSSPISRRFNNLFGKTGTYN
VSTPETTSSSLENSSSAYSLLN
Download sequence
Identical sequences 9544.ENSMMUP00000030287 ENSMMUP00000030287 ENSMMUP00000033554 ENSMMUP00000030285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]