SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033659 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033659
Domain Number 1 Region: 271-398
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-19
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 475-544
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.22e-18
Family TB module/8-cys domain 0.00000899
Further Details:      
 
Domain Number 3 Region: 109-175
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.83e-16
Family TB module/8-cys domain 0.00094
Further Details:      
 
Domain Number 4 Region: 642-758
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000124
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 399-590
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000022
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 29-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000342
Family EGF-type module 0.00042
Further Details:      
 
Domain Number 7 Region: 190-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000012
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 8 Region: 233-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000664
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 9 Region: 594-651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000156
Family EGF-type module 0.00043
Further Details:      
 
Domain Number 10 Region: 71-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000614
Family EGF-type module 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000033659
Domain Number - Region: 1-50
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0255
Family TB module/8-cys domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033659   Gene: ENSMMUG00000004239   Transcript: ENSMMUT00000040613
Sequence length 842
Comment pep:known chromosome:MMUL_1:7:26734759:26793416:-1 gene:ENSMMUG00000004239 transcript:ENSMMUT00000040613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPAVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPT
GYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNNCMDMRRSLC
YRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFATLCGSQRPGF
VIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVCEDIDECQNG
PVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNICSHGQCIDTVGSFYCL
CHTGFKTNADQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSHNNDCIDVDECA
SGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLEPRKCAPGTCQNLDGS
YRCICPPGYSLQDDKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSLSSSGRRCQD
LRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEAFRQICPYGS
GIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILAGNECVDTDECSVGNP
CGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYGSYECKCPVG
YVLREDRRMCRDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDGEGCVDENEC
QTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECLDVILSLLLLSPAFPSCFFSPRTI
GKGTASQRCYKTCVRSAPATGTLSPNLNAAVMEGEAGVPTVRSALSRGLWLSRNSVPMAE
DS
Download sequence
Identical sequences ENSMMUP00000033659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]