SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033720 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033720
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.07e-31
Family PDI-like 0.0019
Further Details:      
 
Domain Number 2 Region: 90-193
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.72e-20
Family PDI-like 0.0084
Further Details:      
 
Domain Number 3 Region: 191-326
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000626
Family PDI-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033720   Gene: ENSMMUG00000001682   Transcript: ENSMMUT00000040684
Sequence length 326
Comment pep:known chromosome:MMUL_1:7:22091515:22160794:1 gene:ENSMMUG00000001682 transcript:ENSMMUT00000040684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFR
DGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASVVGFFDDLFSEA
HSEFLKAASNLRDNYRFAHTNVKSLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTEQKM
TSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVA
KKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGK
ALERFLQDYFDGNLKRYLKSEPIPES
Download sequence
Identical sequences ENSMMUP00000033720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]