SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034032 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034032
Domain Number 1 Region: 79-152
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034032   Gene: ENSMMUG00000019583   Transcript: ENSMMUT00000041001
Sequence length 942
Comment pep:known chromosome:MMUL_1:6:136939750:136954164:1 gene:ENSMMUG00000019583 transcript:ENSMMUT00000041001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVNSSKYPSLLLHSQEEKTSTATSKTQTRLEGEVNPNSLSTSYKTVSLPLSSPNIKLNL
TSPKRGQKREEGWKEVVRRSKKLSVPASVVSRIMGRGGCNITAIQDVTGAHIDVDKQKDK
NGERMITIRGGTESTRYAVQLINALIQDPAKELEDLIPKNHIRTPASTKSIHANFSSGVG
TTAASSKNAFPLGAPTLVTSQATTLSTFQPANKLNKNVPTNVRSSFPVSLPLAYPHPHFA
LLAAQTMQQIRHPRLPMAQFGGTFSPSPNTWGPFPVRPVNPGNTNSSPKHNNTSRLPNQN
GTVLPSESAGLATASCPITVSSVVAANQQLCVTNTRTPSSVRKQLFACVPKTSPPATVIS
SVTSTCSSLPSVSSAPITSGQAPTTFLPASTSQAQLSSQKMESFSAVPPTKEKVSTQDQP
MANLCTPSSAANSCSSSASNTPGAPETHPSSSPTPTSGNTQEEAQPSSVCDLSPMSMPFA
SNSEPAPLTLTSPRMVAADNQDTSNLPQLAVPAPRVSHRMQPRGSFYSMVPNATIHQDPQ
SIFVTNPVTLTPPQGPPATVQLSSAVNIMNGSQMHINPANKSLPPTFGPATLFNHFSSLF
DSSQVPSNQGWGDGPLSSRVAADASFTVQSAFLGNSVLGHLENMHPDNSKAPGFRPPSQR
VSTSPVGLPSIDPSGSSPSSSSAPLTSFSGIPGTRVFLQGPAPVGTPSFNRQHFSPHPWT
SASNSCDSPIPSVSSESSSPLSATSAPPTLGQPKGVSASQDRKIPPPIGTERLARIRQGG
SVAQAPVGTSFVAPVGHSGIWSFGVNAVSEGLSGWSQSVMGNHPMHQQLSDPSTFSQHQP
MERDDSGMVAPSNIFHQPMASGFVDFSKGLPISMYGGTIIPSHPQLADVPGGPLFNGLHN
PDPAWNPMIKVIQNSTECTDAQQIWPGTWAPHIGNMHLKYVN
Download sequence
Identical sequences 9544.ENSMMUP00000034032 ENSMMUP00000034032 ENSMMUP00000034032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]