SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034294 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034294
Domain Number 1 Region: 426-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 314-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.73e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 4 Region: 650-707
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.81e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 538-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 23-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-24
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 7 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-23
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 8 Region: 482-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.03e-23
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 9 Region: 594-651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.81e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 10 Region: 692-744
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 11 Region: 220-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034294   Gene: ENSMMUG00000008060   Transcript: ENSMMUT00000041260
Sequence length 751
Comment pep:known_by_projection chromosome:MMUL_1:4:27211692:27233935:-1 gene:ENSMMUG00000008060 transcript:ENSMMUT00000041260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDLSSPDSTLHQGGHNLLSSASFQESVTFKDVIVDFTQEEWKQLDPGQRDLFRDVTLEN
YTHLVSIGLQDSKPDVISQLEQGTEPWIMEPSIPVGTCADWETRLENSVSAPEPDISEEE
LSPEVIVEKHKRDDSWSSNLLESWECEGSLERQQANQQTLPKEIKVTEKTIPSWEKGPVN
NEFGKSVTVSSNLVTQEPSPEETSVKRSIKQNSNPVKKEKSCKCNECGKAFSYCSALIRH
QRTHTGEKPYKCNECEKAFSRSENLINHQRIHTGDKPYKCDQCGKGFIEGPSLTQHQRIH
TGEKPYKCDECGKAFSQRTHLVQHQRIHTGEKPYTCNECGKAFSQRGHFMEHQKIHTGEK
PFKCDECDKTFTRSTHLTQHQKIHTGEKTYKCNECGKAFNGPSTFIRHHMIHTGEKPYEC
NECGKAFSQHSNLTQHQKTHTGEKPYDCAECGKSFSYWSSLAQHLKIHTGEKPYKCNECG
KAFSYCSSLTQHRRIHTREKPFECSECGKAFSYLSNLNQHQKTHTQEKAYECKECGKAFI
RSSSLAKHERIHTGEKPYQCHECGKTFSYGSSLIQHRKIHTGERPYKCNECGRAFNQNIH
LTQHKRIHTGAKPYECTECGKAFRHCSSLAQHQKTHTEEKPYQCNKCEKTFSQSSHLTQH
QRIHTGEKPYKCNECDKAFSRSTHLTEHQNTHTGEKPYNCNECRKTFSQSTYLIQHQRIH
SGEKPFGCNDCGKSFRYRSALNKHQRLHPGI
Download sequence
Identical sequences F7H2W9
ENSMMUP00000010565 ENSMMUP00000034294 9544.ENSMMUP00000034294 XP_014991240.1.72884 XP_014991241.1.72884 XP_014991242.1.72884 ENSMMUP00000010565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]