SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034812 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034812
Domain Number 1 Region: 23-229
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.11e-34
Family Laminin G-like module 0.0062
Further Details:      
 
Domain Number 2 Region: 246-468
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-27
Family Laminin G-like module 0.002
Further Details:      
 
Domain Number 3 Region: 495-533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000629
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000034812
Domain Number - Region: 468-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0296
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034812   Gene: ENSMMUG00000011810   Transcript: ENSMMUT00000041802
Sequence length 1047
Comment pep:known chromosome:MMUL_1:5:117794742:117833894:1 gene:ENSMMUG00000011810 transcript:ENSMMUT00000041802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCESSVNYCECNPCFNGGSCQSGVDSYYCHCPFGVFGKHCELNSYGFEELSYMEFPSLDP
NNNYIYVKFATIKSHALLLYNYDNQTGDRAEFLALEIAEERLRFSYNLGSGTYKLTTMKK
VSDGHFHTVIARRAGMAASLTVDSCSENQEPGYCTVSNVAVSDDWTLDVQPNRVTVGGIR
SLEPILQRRGHVESHDFVGCIMEFAVNGRPLEPSQALAAQGILDQCPRLEGACTRSPCQH
GGTCMDYWSWQQCHCKEGLTGKYCEKSLTPDTALSLEGKGRLDYHMSQNEKREYLLRQSI
RGAMLEPFGVNSLEVKFRTRSENGILIHIQESSNYTTVKIKNGKVHFTSDAGIAGKVERN
IPEVYVADGHWHTFLIGKNGTATVLSVDRIYNRDIIHPTQDFGGLDVLTISLGGIPPNQA
HRDAQTGFDGCIASMWYGGESLPFSGKHSLASISKTDPSVKIGCRGPNICASNPCWGDLL
CINQWYAYRCVPPGDCASHPCQNGGSCEPGLDSGFTCSCPDSHTGRTCEMVVACLGVLCP
QGKVCKAGSPAGHVCVLSQGPEEISLPLWAVPAIVGSCATVLALLVLSLILCNQCRGKKA
KNPKEEKKPKEKKKKGSENVAFDDPDNIPPYGDDMTVRKQPEGNPKPDIIERENPYLIYD
ETDIPHNSETIPSAPLASPEQEIEHYDIDNASSIAPSDADIIQHYKQFRSHTPKFSIQRH
SPLGFARQSPMPLGASSLTYQPSYGQGLRTSSLSHSACPTPNPLSRHSPAPFSKSSTFYR
NSPARELHLPIRDGNTLEMHGDTCQPGIFNYATRLGRRSKSPQAMASHGSRPGSRLKQPI
GQIPLESSPPVGLSIEEVERLNTPRPRNPSICSADHGRSSSEEDCRRPLSRTRNPADGIP
APESSSDSDSHESFTCSEMEYDREKPMVYTSRMPKLSQVNESDADDEDNYGARLKPRRYH
GRRAEGGPVGTQAAAPGAADNTLPIKLGQQAGTFNWDNLLNWGPGFGHYVDVFKDLASLP
EKAAANEEGKAGTTKPVPKDGEAEQYV
Download sequence
Identical sequences ENSMMUP00000034812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]