SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035745 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035745
Domain Number 1 Region: 33-275
Classification Level Classification E-value
Superfamily Aldolase 1.78e-59
Family Class I aldolase 0.0000346
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035745   Gene: ENSMMUG00000020033   Transcript: ENSMMUT00000042736
Sequence length 322
Comment pep:known_by_projection chromosome:MMUL_1:9:97165540:97183166:1 gene:ENSMMUG00000020033 transcript:ENSMMUT00000042736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGPQVWSSVRQGLSRSLSRNVRGWASGEGKKVDIAGIYPPVTTPFTATAEVDYGKLEEN
LHKLGTFPFRGFVVQGSNGEFPFLTSSERLEVVSRVRQAMPKNKLLLAGSGCEVSHNALM
AQVGADVAMVVTPCYYRGRMSSAALIHHYTKVADLSPIPVVLYSVPANTGLDLPVDAVVT
LSQHPNIVGMKDSGGDVTRIGLIVHKTRKQDFQVLAGSAGFLMASYALGAVGGVCALANV
LGAQVCQLERLCLTGQWEDAQKLQHRLIEPNAAVSQWQQGRGMGGGQSVSSLEQDPGLAP
GPTQSLPFRKSFERTFQCGNSL
Download sequence
Identical sequences ENSMMUP00000035745 ENSMMUP00000035745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]