SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035989 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035989
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 484-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.37e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.61e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 262-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 596-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 318-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.08e-21
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 541-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-19
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-19
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 9 Region: 224-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000363
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 10 Region: 642-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000493
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000035989
Domain Number - Region: 166-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0176
Family Classic zinc finger, C2H2 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035989   Gene: ENSMMUG00000001462   Transcript: ENSMMUT00000042977
Sequence length 683
Comment pep:known chromosome:MMUL_1:9:37960262:37973158:1 gene:ENSMMUG00000001462 transcript:ENSMMUT00000042977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGSLSFEDVTVGFTQEEWQHLDPAQRTLYRDVMIENYSHLVSVGYCIPKQEVIFKLEQGE
QPWILEEELPGQRYPDELACIKQKDASDMSSFLNDDITRLISYGYFFLFLEVCKVDDQLE
RCQEIQDRHIWQAPYINNQILTIERGNILGKVFDFSIDPLPSIKIPCKCDLCGMSLKYIS
DLFSSKKNYLRKMPHDLSAYRKLFLNSNHEKTHIYKQAYTGESPCVHNECNKVFYNNPTL
TVHKITHRGEEVYGCEQCGKPFYEQSKLTKHQRIHTGEKPYECNECEKCFSRKSPLTLHQ
RVHTGEKPYKCKECGKCFSRNSHLILHQRTHTGEKPYKCKECRKSFFHKSYLTVHQRIHM
EKPYECNQCGKTFISNSVLIIHHKTHTGEKPCECNECGKSFSRSSYLIIHQRTHTGEKPY
ECKICGKTFCHKSDVTKHQKTHIGGKPYECIQCGKTFSHNSGLKVHQRTHTKEKPYEYTE
YGKSFSEKSVLTVHQRIHTGEKPYKCNECGKTFYNKSDLTKHQRTHTGKKPYRCKECGKF
FSRNSYLTIHQRMHTGDKPFVCKKCGKTLYHKADYTVHKRTHRGEKSYYCNECGKTFICN
SVLNSHQRKHMGEKPYGCNECGKSFSEKSVLTVHQRIHTGEKPYKCNECGKYYHKSDLTK
HQRTHTREKPYECSQCGKSFSCS
Download sequence
Identical sequences ENSMMUP00000035989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]