SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035990 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035990
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.26e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 392-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 224-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.32e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 504-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 281-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 449-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.83e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 7 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-19
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 8 Region: 186-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.86e-18
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 9 Region: 548-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.72e-18
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000035990
Domain Number - Region: 131-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.014
Family Classic zinc finger, C2H2 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035990   Gene: ENSMMUG00000001462   Transcript: ENSMMUT00000042978
Sequence length 618
Comment pep:known chromosome:MMUL_1:9:37960262:37973346:1 gene:ENSMMUG00000001462 transcript:ENSMMUT00000042978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGSLSFEDVTVGFTQEEWQHLDPAQRTLYRDVMIENYSHLVSVGYCIPKQEVIFKLEQGE
QPWILEEELPGQRYPEVCKVDDQLERCQEIQDRHIWQAPYINNQILTIERGNILGKVFDF
SIDPLPSIKIPCKCDLCGMSLKYISDLFSSKKNYLRKMPHDLSAYRKLFLNSNHEKTHIT
HRGEEVYGCEQCGKPFYEQSKLTKHQRIHTGEKPYECNECEKCFSRKSPLTLHQRVHTGE
KPYKCKECGKCFSRNSHLILHQRTHTGEKPYKCKECRKSFFHNNSVLIIHHKTHTGEKPC
ECNECGKSFSRSSYLIIHQRTHTGEKPYECKICGKTFCHKSDVTKHQKTHIGGKPYECIQ
CGKTFSHNSGLKVHQRTHTKEKPYEYTEYGKSFSEKSVLTVHQRIHTGEKPYKCNECGKT
FYNKSDLTKHQRTHTGKKPYRCKECGKFFSRNSYLTIHQRMHTGDKPFVCKKCGKTLYHK
ADYTVHKRTHRGEKSYYCNECGKTFICNSVLNSHQRKHMGEKPYGCNECGKSFSEKSVLT
VHQRIHTGEKPYKCNECGKYYHKSDLTKHQRTHTREKPYECSQCGKSFSCSLGLKVYQRR
HTREKPYGSIHTSKYLGE
Download sequence
Identical sequences ENSMMUP00000035990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]