SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035993 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035993
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 509-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.52e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 397-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.27e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 287-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.3e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 621-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 343-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.4e-21
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 566-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-19
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 453-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.72e-19
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 9 Region: 677-731
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.84e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 231-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000279
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000035993
Domain Number - Region: 178-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0511
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035993   Gene: ENSMMUG00000001462   Transcript: ENSMMUT00000042981
Sequence length 731
Comment pep:known chromosome:MMUL_1:9:37960250:37973227:1 gene:ENSMMUG00000001462 transcript:ENSMMUT00000042981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVLFQGSLSFEDVTVGFTQEEWQHLDPAQRTLYRDVMIENYSHLVSVGYCIPKQEVIFKL
EQGEQPWILEEELPGQRYPGVCSYVRIFSVSVYRSSRNNKEKEQHKVYLMTIELIKCILG
CQTEKRIVRENKNHSKESNKCERFTHTCTPSKDNIKIFHNLKKSSFLKMPHDLSAYRKLF
LNSNHEKTHMEEKRYEFIQIGKCLSHKEDFISYLKIQNLEQSEYKECEKDFYGKAVFITY
KQAYTGESPCVHNECNKVFYNNPTLTVHKITHRGEEVYGCEQCGKPFYEQSKLTKHQRIH
TGEKPYECNECEKCFSRKSPLTLHQRVHTGEKPYKCKECGKCFSRNSHLILHQRTHTGEK
PYKCKECRKSFFHKSYLTVHQRIHMGEPYECNQCGKTFISNSVLIIHHKTHTGEKPCECN
ECGKSFSRSSYLIIHQRTHTGEKPYECKICGKTFCHKSDVTKHQKTHIGGKPYECIQCGK
TFSHNSGLKVHQRTHTKEKPYEYTEYGKSFSEKSVLTVHQRIHTGEKPYKCNECGKTFYN
KSDLTKHQRTHTGKKPYRCKECGKFFSRNSYLTIHQRMHTGDKPFVCKKCGKTLYHKADY
TVHKRTHRGEKSYYCNECGKTFICNSVLNSHQRKHMGEKPYGCNECGKSFSEKSVLTVHQ
RIHTGEKPYKCNECGKYYHKSDLTKHQRTHTREKPYECSQCGKSFSCSLGLKVYQRRHTR
EKPYGCKQCGE
Download sequence
Identical sequences ENSMMUP00000035993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]