SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036003 from Macaca mulatta 76_1

(show help)
Strong hits

Sequence:	ENSMMUP00000036003
Domain Number 1	Region: 38-101
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	3.42e-17
Family	LIM domain	0.0014
Further Details:

Domain Number 2	Region: 161-222
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	3.96e-16
Family	LIM domain	0.002
Further Details:

Domain Number 3	Region: 219-282
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	9.36e-16
Family	LIM domain	0.0011
Further Details:

Domain Number 4	Region: 125-159
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000000000649
Family	LIM domain	0.00087
Further Details:

Domain Number 5	Region: 1-35
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000328
Family	LIM domain	0.0028
Further Details:

Domain Number 6	Region: 96-127
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000000497
Family	LIM domain	0.0015
Further Details:

Weak hits

Sequence:	ENSMMUP00000036003
Domain Number -	Region: 278-307
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.018
Family	LIM domain	0.024
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

External link(s)	Protein: ENSMMUP00000036003 Gene: ENSMMUG00000004179 Transcript: ENSMMUT00000042991
Sequence length	411
Comment	pep:known chromosome:MMUL_1:13:134098372:134142606:-1 gene:ENSMMUG00000004179 transcript:ENSMMUT00000042991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MSDALANAVCQRCQARFAPAERIVNSNGELYHEHCFVCAQCFRPFPEGLFYEFEGRKYCE HDFQMLFAPCCGSCGEFIIGRVIKAMNNNWHPGCFRCELCDVELADLGFVKNASRHLCRP CHNREKAKGLGKYICQRCHLVIDEQPLMFRSDAYHPDHFNCTHCGKELTAEARELKGELY CLPCHDKMGVPICGACRRPIEGRVVNALGKQWHVEHFVCAKCEKPFLGHRHYEKKGLAYC ETHYNQLFGDVCYNCSHVIEGDVVSALNKAWCVSCFSCSTCNSKLTLKNKFVEFDMKPVC KRCYEKFPLELKKRLKKLSELTSRPSPRPRTSTLPEGPLARLSGPLPSPLPLSLLSPLGP VHLRLPHLTLPFSFLIASSLPVPSSLPSPCLSSPWLWLPSVRRQELGSGSL
Download sequence
Identical sequences	ENSMMUP00000036003 9544.ENSMMUP00000036003 ENSMMUP00000036003

SEARCH