SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036221 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036221
Domain Number 1 Region: 21-146
Classification Level Classification E-value
Superfamily Cadherin-like 1.93e-31
Family Cadherin 0.00092
Further Details:      
 
Domain Number 2 Region: 238-329
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-23
Family Cadherin 0.0016
Further Details:      
 
Domain Number 3 Region: 133-242
Classification Level Classification E-value
Superfamily Cadherin-like 2.49e-17
Family Cadherin 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000036221
Domain Number - Region: 2-26
Classification Level Classification E-value
Superfamily Cadherin-like 0.0455
Family Cadherin 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036221   Gene: ENSMMUG00000005620   Transcript: ENSMMUT00000043210
Sequence length 329
Comment pep:known chromosome:MMUL_1:17:47355919:47360415:-1 gene:ENSMMUG00000005620 transcript:ENSMMUT00000043210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDA
DIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP
ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKV
ICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKL
EDENDNPPVFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDR
KTGVLTASRVFDREEQERFIFTVTARDNG
Download sequence
Identical sequences ENSMMUP00000036221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]