SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036423 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036423
Domain Number 1 Region: 31-128
Classification Level Classification E-value
Superfamily C-type lectin-like 1.63e-17
Family C-type lectin domain 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036423   Gene: ENSMMUG00000002857   Transcript: ENSMMUT00000043423
Sequence length 130
Comment pep:known_by_projection chromosome:MMUL_1:13:79248168:79433503:1 gene:ENSMMUG00000002857 transcript:ENSMMUT00000043423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPPMALPSLSWMLLSYFVLLSHFKGCEEPQKELPSARIHCPKGSKAYGSHCYALFLSPK
SWMDADSSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDNNCDA
KLPYVCKFKD
Download sequence
Identical sequences ENSMMUP00000036423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]