SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036447 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036447
Domain Number 1 Region: 8-194
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.22e-59
Family Glutathione peroxidase-like 0.000000046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036447   Gene: ENSMMUG00000004923   Transcript: ENSMMUT00000006946
Sequence length 197
Comment pep:novel chromosome:MMUL_1:17:9737942:9740437:1 gene:ENSMMUG00000004923 transcript:ENSMMUT00000006946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSNAHVEKPAPDFKATAMVDGAFKEVKLWDYKGKYVVLFFYPLDFTFVCPTEIIAFSN
HTENFRKLGCEVLGVLVDSQFTHLAWINTPQKEVGLGPLNIPLRADATRRLSEDYGVLKT
DEGIAYRGLFYTDGGVLRQITVNDLPVGRSLDEALQLVRAIQYTDEHREVCPAGWKLGSD
KIKPNVNKSQKYRTYHL
Download sequence
Identical sequences 9544.ENSMMUP00000036447 ENSMMUP00000036447 ENSMMUP00000036447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]