SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036506 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036506
Domain Number 1 Region: 317-364
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.28e-17
Family TRASH domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036506   Gene: ENSMMUG00000030812   Transcript: ENSMMUT00000043504
Sequence length 1381
Comment pep:known chromosome:MMUL_1:17:1413908:1541217:-1 gene:ENSMMUG00000030812 transcript:ENSMMUT00000043504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSSVGGLELTDQTPVLLGSTAMATSLTNVGNSFSGPANPLVSRSNKFQNSSVEDDDDV
VFIEPVQPPPPSVPVVADQRTITFTSSKNEELQGNDSKITPSSKELASQKGSVSETIVID
DEEDTETNQGQEKNSSNFIERRPPETKNRTNDVDFSTSSFSRSKVNAGMGNSGITTEPDS
EIQIANVTTLETGVSSVNDGQLENTDGRDMNLMITHVTSLQNTNLGDVSNGLQSSNFGVN
IQTYTPSLTSQTKTGVGPFNPGRMNVAGDVFQNGESATHHNPDSWISQSASFPRNQKQPG
VDSLSPVASLPKQIFQPSAQQQPTKPVKVTCANCKKPLQKGQTAYQRKGSAHLFCSTTCL
SSFSHKPAPKKLCVMCKKDITTMKGTIVAQVDSSESFQEFCSTSCLSLYEDKQNPTKGAL
NKSRCTICGKLTEIRHEVSFKNMTHKLCSDHCFNRYRMANGLIMNCCEQCGEYLPSKGAG
NNVLVIDGQQKRFCCQSCVSEYKQVGSHPSFLKEVRDHMQDSFLMQPEKYGKLTTCTGCR
TQCRFFDMTQCIGPNGHMEPYCSTACMNSHKTKYAKSQSLGIICHFCKRNSLPQYQATMP
DGKLYNFCNSSCVAKFQALSMQSSPNGQFVAPSDIQLKCNYCKNSFCSKPEILEWEASLH
QFCSKTCSDDYKKLHCIVTYCEYCQEEKTLHETVNFSGVKRPFCSEGKCCKLLYKQDFAR
RLGLRCVTCNYCSQLCKKGATKELDGVVRDFCSEDCCKKFQDWYYKAIAARCDCCKSQGT
LKERVQWRGEMKHFCDQHCLLRFYCQQNEPNMTTQKGPENLHYDQGCQTSRTKMTGSAPP
PSPTPNKEMKNKAVLCKPLTMTKATYCKPHMQTKSCQTDDTWKTEYVPVPIPVPVYIPVP
MHMYSQNIPVPTTVPVPVPVPVFLPTPLDSSEKIPAAIEELKSKVSSDPLDTELLTMTDM
MSEDEGKTETANINSVIIETDIIGSDLLKNSDPETQSSMPDVPYEPDLDIEIDFPRAAEE
LDMENEFLLPPVFGEEYEEQPRPRSKKKGAKRKAVSGYQSHDDSSDNSECSFPFKYTYGV
NAWKHWVKTRQLDEDLLVLDELKSSKSVKLKEDLLSHTTAELNYGLAHFVNEIRRPNGEN
YAPDSIYYLCLGIQEYLGGSNRKDNIFIDPGYQTFEQELNKILRSWQPSILPDGSIFSRV
EEDYLWRIKQLGSHSPVALLNTLFYFNTKYFGLKTVEQHLRLSFGTVFRHWKKNPLTMEN
KACLRYQVSSLCGTDNEDKITTGKRKHEDDEPVFEQIENTANPSRCPVKMFECYLSKSPQ
NLNQRMDVFYLQPECSSSTDSPVWYTSTSLDRNTLENMLVRVLLVKDIYDKDNYELDEDT
D
Download sequence
Identical sequences ENSMMUP00000002567 ENSMMUP00000036503 ENSMMUP00000036506 9544.ENSMMUP00000036506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]