SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036757 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036757
Domain Number 1 Region: 207-316
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.5e-34
Family PDI-like 0.0037
Further Details:      
 
Domain Number 2 Region: 69-177
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.35e-33
Family PDI-like 0.0021
Further Details:      
 
Domain Number 3 Region: 328-437
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000571
Family DsbC/DsbG C-terminal domain-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036757   Gene: ENSMMUG00000012864   Transcript: ENSMMUT00000043768
Sequence length 488
Comment pep:known chromosome:MMUL_1:13:10876895:10927730:-1 gene:ENSMMUG00000012864 transcript:ENSMMUT00000043768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIITAPASKVSRGSNEFMILVRRSDRAPESSPAHSLSKKSPIRYPSTTMVNAPSLVSCA
FFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATAL
KDVVKVGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALR
QLVKDRLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDVWMVEFYAPWCGH
CKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDY
DGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAG
RNSYLEVLLKMADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAINARKMKFALL
KGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVEL
DDLGKDEL
Download sequence
Identical sequences A0A2K5MMY0 A0A2K5X6A1 A0A2K5YVN1 A0A2K6BPQ6 F6ZB86
ENSMMUP00000036757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]