SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037144 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037144
Domain Number 1 Region: 237-385
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.18e-43
Family Nuclear receptor ligand-binding domain 0.0000000754
Further Details:      
 
Domain Number 2 Region: 95-181
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.27e-29
Family Nuclear receptor 0.0000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037144   Gene: ENSMMUG00000015598   Transcript: ENSMMUT00000044138
Sequence length 387
Comment pep:known_by_projection chromosome:MMUL_1:14:24850287:24869826:-1 gene:ENSMMUG00000015598 transcript:ENSMMUT00000044138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVWLGAPVPDIPPDSAAELWKPGAQDASSQTQGGNSRILREEARMPHSATGTAGVGLEA
AEPTVLLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAHAISLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences F6ST28
ENSMMUP00000020464 ENSMMUP00000037144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]