SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037409 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037409
Domain Number 1 Region: 22-153
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000045
Family FAD/NAD-linked reductases, N-terminal and central domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037409   Gene: ENSMMUG00000011429   Transcript: ENSMMUT00000044394
Sequence length 319
Comment pep:known_by_projection chromosome:MMUL_1:10:53407413:53592452:1 gene:ENSMMUG00000011429 transcript:ENSMMUT00000044394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISYALNHTNRKLTLEPKITVNAKIIVVGASNVGISFLETLVFCSHLKFNNLTLISTHGLP
GKKLLDTEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTGEIVLY
DHLILCTGQQYQVPCPTGADISQHLTNREVPNSSQRRYTGKVPCNHFTLNEEEDCFKALT
WIRNNSITTEGNVIVYGNTIDTYTTVETLLNLGVSGSRVHLVQPPPASTITCINNYSVES
AVADALAAAGVTIYRDAILAQWNDGLHPDPIYSASFTTPTKPFRLPCSGAFFLGLTIICI
LPSLPFLLPWRYKWHSLIM
Download sequence
Identical sequences ENSMMUP00000037409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]