SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037470 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037470
Domain Number 1 Region: 135-254
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.2e-26
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000366
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000037470
Domain Number - Region: 274-296
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000297
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037470   Gene: ENSMMUG00000022606   Transcript: ENSMMUT00000044453
Sequence length 610
Comment pep:known_by_projection chromosome:MMUL_1:14:9678150:9692274:1 gene:ENSMMUG00000022606 transcript:ENSMMUT00000044453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIED
LTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALN
PDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGK
GSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLR
KMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDP
QSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGACHHTLGQCTSSCCSRQQPTSTVSHV
YHPESPTLDEFWPFRESALPWHAWRWSWWARRWPPQLPTPITQPDRWAWWTSHAAQPQWT
PTPLDAATTTTDEPGPPPSWAPWPSSNGSVPGKYACGLWGLSPASRKRYDAAATYGHDAA
TAAASQWAAPTPSLWSSSPMATAAAAASATPSAQQQYGFQYPLAMAAKYDDYHHERWHRV
HPAMATAAGGCRSFSRSPSDARQPHYGAPAPRGPAASAAWGPSPSAASTTWFRRHDVCPA
PSSSASHGPF
Download sequence
Identical sequences ENSMMUP00000037470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]