SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037834 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037834
Domain Number 1 Region: 35-152
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000136
Family V set domains (antibody variable domain-like) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037834   Gene: ENSMMUG00000006017   Transcript: ENSMMUT00000044812
Sequence length 234
Comment pep:known chromosome:MMUL_1:12:67574108:67603065:1 gene:ENSMMUG00000006017 transcript:ENSMMUT00000044812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCGLSALIMCLKGMVAVVVAVDDGDSQALAGNKILVKQSPMLVAYDNAVNLSCKYSYNL
FSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQ
TDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWALVVVGGVLACY
SLLVTVAFCIFWMRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Download sequence
Identical sequences G7N8Q2 G7PL87
ENSMMUP00000007905 9544.ENSMMUP00000037834 ENSMMUP00000037834 XP_011716294.1.29376 XP_014966207.1.72884 XP_015287619.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]