SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037976 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037976
Domain Number 1 Region: 162-324
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-26
Family Voltage-gated potassium channels 0.0027
Further Details:      
 
Domain Number 2 Region: 341-459
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0000925
Family Potassium channel NAD-binding domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037976   Gene: ENSMMUG00000021082   Transcript: ENSMMUT00000044963
Sequence length 1070
Comment pep:known chromosome:MMUL_1:1:173922073:174318792:1 gene:ENSMMUG00000021082 transcript:ENSMMUT00000044963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDLESEVPPLPPRYRFRDLLLGDQGWQNDDRVQVEFYMNENTFKERLKLFFIKNQRSSL
RIRLFNFSLKLLSCLLYIIRVLLENPSQGNEWSHIFWVNRSLPLWGLQVSVALISLFETI
LLGYLSYKGNIWEQILRIPFILEIINAVPFIISIFWPSLRNLFVPVFLNCWLAKHALENM
INDLHRAIQRTQSAMFNQVLILISTLLCLIFTCICGIQHLERIGKKLNLFDSLYFCIVTF
STVGFGDVTPETWSSKLFVVAMICVALVVLPIQFEQLAYLWMERQKSGGNYSRHRAQTEK
HVVLCVSSLKIDLLMDFLNEFYAHPRLQDYYVVILCPTEMDVQVRRVLQIPMWSQRVIYL
QGSALKDQDLLRAKMDDAEACFILSSRCEVDRTSSDHQTILRAWAVKDFAPNCPLYVQIL
KPENKFHINLLVNHVVCEEEFKYAMLALNCICPATSTLITLLVHTSRGQFGVCLIGVRRE
DNKNILLNPGPRYIMNSTDICFYINITKEENSAFKNQDQQRKSNVSRSFYHGPSRLPVHS
IIASMGTVAIDLQDTSCRSASGPTLSLPTEGSKEVRRPSIAPVLEVADTSSIQTCDLLSD
QSEDETTPDEEISSNLEYAKGYPPYSPYIGSSPTFCHLLHEKVPFCCLRLDKSCQHNYYE
DAKAYGFKNKLIIVAAETAGNGLYNFIVPLRAYYRPKKELNPIVLLLDNPLDDLLRCGVT
FAANMVVVDKESTMSAEEDYMADAKTIVNVQTLFRLFSSLSIITELTHPANMRFMQFRAK
DCYSLALSKLEKKERERGSNLAFMFRLPFAAGRVFSISMLDTLLYQSFVKDYMISITRLL
LGLDTTPGSGFLCSMKITADDLWIRTYARLYQKLCSSTGDVPIGIYRTESQKLTTSEETK
ILIFSSQISISVEEWEDTKDSREQGHHRGNHRNSTSSDQSDHPLLRRKSMQWARRLSRKG
PKHSGKTAEKITQQRLNLYRRSERQELAELVKNRMKHLGLSTVGYDEMNDHQSTLSYILI
NPSPDTRIELNDVVYLIRPDPLAYLPNSEPSRRNSICNVTGQDSREETQL
Download sequence
Identical sequences ENSMMUP00000037976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]