SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038000 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038000
Domain Number 1 Region: 21-66
Classification Level Classification E-value
Superfamily BPTI-like 8.23e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038000   Gene: ENSMMUG00000031338   Transcript: ENSMMUT00000044986
Sequence length 68
Comment pep:known_by_projection chromosome:MMUL_1:10:18934969:18937971:1 gene:ENSMMUG00000031338 transcript:ENSMMUT00000044986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLQASLSFLLILTLCLELRSELSQAYMIRWFFNSETGECELFAYGGCRGNSNNFSRKEE
CEKMCKFT
Download sequence
Identical sequences ENSMMUP00000038000 9544.ENSMMUP00000038000 ENSMMUP00000038000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]