SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038056 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038056
Domain Number 1 Region: 490-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 4-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 434-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.44e-21
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 536-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-16
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 379-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000178
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 281-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000184
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 326-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000101
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038056
Domain Number - Region: 236-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000351
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038056   Gene: ENSMMUG00000002988   Transcript: ENSMMUT00000045041
Sequence length 611
Comment pep:novel chromosome:MMUL_1:10:18019962:18026663:1 gene:ENSMMUG00000002988 transcript:ENSMMUT00000045041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGLLQGSVLFEDVSVDFTQKEWQLLNPAQRLLYRDVMLENYRHLVSMAGHCVTKPELIVK
LKQGEESWILKREPPSQSHSGELRWSVQVLVSLKGEHLNRNREQALLINNKILTKRSKTL
REAFNMATNTVPSRKMSHKCDSFGTSLKSVSEIIINDINHVRKKVSKHNKTHAENKPCEN
DQKKKSPSHNHPKDSSLEQLLEYNNRGKGFHRKIVFVTCKRALMVEKPSERNKYGSFISK
LSLNSRPRTLRERKPYEPGKNGKSSCMKSYTILKMRELVQGRKIYQCKKCGKFFHEKACL
TQHKRAHTTGKPSKCNDSERVLKKESCLTPNQIIKTREKNCKGNKCEKPFFEKLKHTQHQ
RRHSGKKTNGCNESGGASSRKSQLTQSQRAHTEKTCDCNKCGESFHKKTDLRQHQSTHRG
EKKKTYECNECEKSFFVKSNYSEHQRTHTGEKPYKCNECGNSFCQKSAFSVHQRIHTRAK
PYKSNECGKTFCVKSNLTQHQRTHTGEKPYKCNECWRSFCVKSNLVVHQRTHTGEKPYRC
PECGKTFYEKSALTKYELNHTGENPYECNKCRKTFSQRSSLTKHQRKKISIGVKPHECFE
HVKAFSKYSEL
Download sequence
Identical sequences ENSMMUP00000038056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]