SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038060 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038060
Domain Number 1 Region: 520-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 7-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.34e-21
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 566-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-16
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 410-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000882
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 311-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000199
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 356-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000068
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038060   Gene: ENSMMUG00000002988   Transcript: ENSMMUT00000045045
Sequence length 635
Comment pep:novel chromosome:MMUL_1:10:18019953:18026645:1 gene:ENSMMUG00000002988 transcript:ENSMMUT00000045045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WSRIGLLQGSVLFEDVSVDFTQKEWQLLNPAQRLLYRDVMLENYRHLVSMAGHCVTKPEL
IVKLKQGEESWILKREPPSQSHSGELSEHLNRNRERNVLRFIMQALLINNKILTKRSKTL
REAFNMATNTVPSRKMSHKCDSFGTSLKSVSEIIINDINHVKKSVEFSRCDFLYIKHNKT
HAENKPCENDQKKKSDFVQHPKDSSLEQLLEYNNRGKGFHRKIVFVTCKRALMVEKPSER
NKYGQLSLNSRPRTLRERKPYEPGKNGKSSCMKSKHALKKFTQGKNTMKSNFTQHQRISY
TILKMRELVQGRKIYQCKKCGKFFHEKACLTQHKRAHTTGKPSKCNDSERVLKKESCLTP
NQIIKTREKNCKGNKCEKPFFEKLKHTQHQRRHSGKKTNGCNESGGASSRKSQLTQSQRA
HTKKTCDCNKCGESFHKKTDLRQHQSTHRGEKKKTYECNECEKSFFVKSNYSEHQRTHTG
EKPYKCNECGNSFCQKSAFSVHQRIHTRAKPYKSNECGKTFCVKSNLTQHQRTHTGEKPY
KCNECWRSFCVKSNLVVHQRTHTGEKPYRCPECGKTFYEKSALTKYELNHTGENPYECNK
CRKTFSQRSSLTKHQRKKISIGVKPHECFEHVKAF
Download sequence
Identical sequences 9544.ENSMMUP00000038060 ENSMMUP00000038052 ENSMMUP00000038060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]