SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038082 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038082
Domain Number 1 Region: 27-122
Classification Level Classification E-value
Superfamily Snake toxin-like 2.14e-24
Family Extracellular domain of cell surface receptors 0.016
Further Details:      
 
Domain Number 2 Region: 133-172
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000376
Family Snake venom toxins 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038082   Gene: ENSMMUG00000017773   Transcript: ENSMMUT00000045066
Sequence length 300
Comment pep:known_by_projection scaffold:MMUL_1:1099548049381:78004:82837:1 gene:ENSMMUG00000017773 transcript:ENSMMUT00000045066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPARKAGAQAMIWNAGWLLLLLLLCRAQALECYSCVQKADDGCSPHKMKTVKCAPGVEV
CTEAVGAVETIHGQFSMGVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLT
SRALDPAGPPNVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFS
PRIPPLVRLPPPEPTTVASTISVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTSRQGAEH
EASQDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNRGGVAPTAGLAALLLAVAAGVLL
Download sequence
Identical sequences ENSMMUP00000038082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]