SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038141 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038141
Domain Number 1 Region: 91-156
Classification Level Classification E-value
Superfamily ERP29 C domain-like 0.0000000000288
Family ERP29 C domain-like 0.0000778
Further Details:      
 
Domain Number 2 Region: 2-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000358
Family ERP29 N domain-like 0.0000416
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038141   Gene: ENSMMUG00000031380   Transcript: ENSMMUT00000045122
Sequence length 158
Comment pep:novel chromosome:MMUL_1:10:12338093:12338582:1 gene:ENSMMUG00000031380 transcript:ENSMMUT00000045122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YGEKQDEFRRLPGNLDSSDDLLVAETGISDYGDKLNMELSETYKLHKESYPVFYLFWEED
FENPVPCTGAVKVGAIQRWLKGKCVYLGMPGGLPAYDALAGEFVRASGVEARQALLKQGQ
DHLSSVRETEKNWAKQHLKIIGKILDLGEDFPASEMTW
Download sequence
Identical sequences ENSMMUP00000038141 9544.ENSMMUP00000038141 ENSMMUP00000038141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]