SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038235 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000038235
Domain Number - Region: 2-32
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0214
Family Ribosomal protein L24e 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038235   Gene: ENSMMUG00000017347   Transcript: ENSMMUT00000024396
Sequence length 132
Comment pep:novel chromosome:MMUL_1:2:187747632:187748279:1 gene:ENSMMUG00000017347 transcript:ENSMMUT00000024396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGKVFQFLNAKCKLAFLSKRNPWQINCTVLYRRKHKKGQLEEIQKKRTRSSQIPEAITGV
SLAAVMTKRNQKPEVRKAQREQAIRAAKEAKEAKQASKKPAMAAAKAPTKATPKQKIVKP
VSFSSSSSGPRD
Download sequence
Identical sequences 9544.ENSMMUP00000038235 ENSMMUP00000038235 ENSMMUP00000038235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]