SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038330 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038330
Domain Number 1 Region: 467-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 1-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-25
Family KRAB domain (Kruppel-associated box) 0.00081
Further Details:      
 
Domain Number 3 Region: 299-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 635-692
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.55e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 243-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 579-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.67e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 523-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.05e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 8 Region: 411-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.8e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 9 Region: 355-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 10 Region: 677-729
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.74e-21
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 11 Region: 203-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000403
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038330
Domain Number - Region: 173-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000578
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038330   Gene: ENSMMUG00000013867   Transcript: ENSMMUT00000045305
Sequence length 738
Comment pep:known_by_projection chromosome:MMUL_1:11:134306555:134327592:1 gene:ENSMMUG00000013867 transcript:ENSMMUT00000045305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMLQESFSFDDLSVDFTQKEWQLLDPSQKNLYKDVMLENYSSLVSLGYEVMKPDVIFKL
EQGEEPWVGDGEIPSSDSPEVWNVNGNMMWHQDNQDKLKIIKRGHECDAFGKNFNLNMNF
VPLRKSNNEGDLDGLILKHHLDLLIPKGDYGKAESDDFNVFDNFFLHSKPEDTDTWLKYY
DCDKYKESYKKSQIIIYHKNRLGEKLYECSECRKRFSKKPSLIKHQSRHIRDIAFGCGNC
GKTFPQKSQFITHHRTHTGEKPYNCSQCGKAFSQKSQLTSHQRTHTGEKPYECGECGKAF
SRKSHLISHWRTHTGEKPYGCSECGRAFSEKSNLINHQRIHTGEKPFECRECGKAFSRKS
QLVTHHRTHTGTKPFGCSDCRKAFFEKSELIRHQTIHTGEKPYECSECRKAFRERSSLIN
HQRTHTGEKPHGCIQCGKAFSQKSHLISHQMTHTGEKPFICSKCGKAFSRKSQLVRHQRT
HTGEKPYECSECGKAFSEKLSLTNHQRIHTGEKPYVCSECGKAFCQKSHLISHQRTHTGE
KPYECTECGKAFGEKSSLATHQRTHTGEKPYECRDCEKAFSQKSQLNTHQRIHTGEKPYE
CSLCRKAFFEKSELIRHLRTHTGEKPYECNECRKAFREKSSLINHQRIHTGEKPFECSEC
GKAFSRKSHLIPHQRTHTGEKPYGCSECRKAFSQKSQLVNHQRIHTGEKPYQCIECGKAF
SQKSQLINHQRTHTVKKS
Download sequence
Identical sequences 9544.ENSMMUP00000018220 ENSMMUP00000018220 ENSMMUP00000018220 ENSMMUP00000038330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]