SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038579 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000038579
Domain Number - Region: 39-100
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000276
Family I set domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038579   Gene: ENSMMUG00000015601   Transcript: ENSMMUT00000045544
Sequence length 223
Comment pep:known_by_projection chromosome:MMUL_1:1:139109882:139114697:-1 gene:ENSMMUG00000015601 transcript:ENSMMUT00000045544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIWSSQTLLPSNLIFLQTGQLRSIQVNNYSQLFQNRTCEIHLTCSVEDADDNVSFRWEAL
GSTLSSEPNITTSWDPRISGEQDYTCIAENAVSNLSFSVSAQKLCGDVKIQYTDTKMILF
VVFGICIVTGFIIMLLLVLRKRRDSLPLSTQRTQGPAEPAGNIEYVSVSPVNNTVYASVT
HSNRETEISTPIKNATVTIYSTVNHSKESKPTFSRATALDNVV
Download sequence
Identical sequences ENSMMUP00000038579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]