SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038707 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038707
Domain Number 1 Region: 775-832
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.73e-26
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 944-1000
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-25
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 831-888
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.1e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 551-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 607-664
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 663-720
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.12e-24
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 719-776
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 9 Region: 887-944
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 10 Region: 985-1037
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-22
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 11 Region: 497-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 12 Region: 389-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-16
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 13 Region: 433-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000866
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 14 Region: 331-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000032
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 15 Region: 293-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000275
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038707   Gene: ENSMMUG00000007614   Transcript: ENSMMUT00000010657
Sequence length 1056
Comment pep:known chromosome:MMUL_1:15:109564102:109576171:-1 gene:ENSMMUG00000007614 transcript:ENSMMUT00000010657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLQASVSFQDVTVEFTQEEWQHLGPVERTLYRDVMLENYSHLISVGYCITKPKVISRLE
QGEEPWSLEDEFLNQKHQGYFKVDHIKGIWEKQEKPLWQEIFISDADKTLSKEREKVLEK
PSNLEIAPEFSEKLPCKCDSHRINLPIASELIISERKYSRKKAEYMNVCEKLQLDINHEK
AHPGQKSYEHGKNAKAYKKYQHWKFQTLEESFECDGSGQGLHDKTICITPESFPTVEKSC
KDDEFRKNFDKTTLFNDMRTDTRGKCSDLNEYGTSCDKTTTVEYNKVHMAMTHYECNERG
INFSRKSPLTQSQRTITGRSAFESNKCEENFRQSSAHIVHQKTQTGDKFGDYNECTNALY
QKLDFTAHQRIHTEDKFYLSDEHGKCRKSFYQKGHLIQHQRPHSGEKPYQYEECAKSFCS
SSHPIQHPGTYVGFKLYECNECGKAFCQNSNLSKHLRIHTKEKPCDNNGCGRSYKLPLTG
HQKTDAEMKLCDGSEYGKTSHLKGHQRILMGEKPYECIECGKTFSKTSHLRAHQRIHTGE
KPYECVECEKTFSHKTHLSVHQRVHTGEKPYECNDCGKSFTYNSALRAHQRIHTGEKPYE
CSDCEKTFAHNSALRAHHRIHTGEKPYECNECGRSFAHISVLKAHQRIHTGEKPYECNEC
GRSFTYNSALRAHQRIHTGRKPYECSDCEKTFAHNSALKIHQRIHTGEKPYECNECEKTF
AHNSALRAHQNIHTGEKLYECNECGKTFFQKTRLSTHRRIHTGEKPYECSKCGKTFSQKS
YLSGHERIHTGEKPYECNICGKTFVYKAALIVHQRIHTGEKPYECNECGKTFSQRTHLCA
HQRIHTGEKPYECNECGKTFADNSALRAHHRIHTGEKPYECNECGKTFSKTSHLRAHLRT
RSGEKPYECNECGKTFSEKSYVSAHQRVHTGEKPYECNVCGKPFAHNSTLRVHQRIHTGE
KSYECNDCGKTFSQKSHLSAHQRIHTGEKPYECNECGKAFAQNSTLRVHQRIHTGEKPYE
CDECGKTFVRKAALRVHHTRMHTREKTLACNGFGKS
Download sequence
Identical sequences ENSMMUP00000013798 ENSMMUP00000038707 9544.ENSMMUP00000038707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]