SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038967 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038967
Domain Number 1 Region: 1322-1565
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.81e-36
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 2 Region: 1012-1160,1193-1273
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.12e-35
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 3 Region: 573-812
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-27
Family Voltage-gated potassium channels 0.014
Further Details:      
 
Domain Number 4 Region: 129-280,334-404
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.3e-17
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038967   Gene: ENSMMUG00000019962   Transcript: ENSMMUT00000045927
Sequence length 1748
Comment pep:known_by_projection chromosome:MMUL_1:2:97576001:97683986:1 gene:ENSMMUG00000019962 transcript:ENSMMUT00000045927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDRCYPVIFPDERNFRPFTSDSLAAIEKRIAIQKEKDKSKDKTGEVPHLRPQLDLKASR
KLPNLYGDIPRELIGKPLEDLDPFYRNHKTFMVLNKKRTIYRFSAKRALFIFGPFNSIRS
LAIRVSGRFTFLMFIIGTVIINCVFMARGPAKNSNSNDTDIAECVFTGIYIFEALIKILA
RGFILDEFSFLRDPWNWLDSIVIGIAIVSCIPGITIKLLSLRTFRVFRALKAISVVSRKS
LSLSTLASRKNKNKVIIHTFFLSSPFPPFYINYTIWPQYLNSRQLESFQTEAVDHCFEKK
ENSTEFKMCGIWMVKSSCSKQYECNHTKSNPDYNYTNFDNFGWSFLAMFRLMTQDSWEKL
YQQTLRTAGLYSVFFFIVVIFLGSFYLINLTLAVVTMAYEEQNKNVAAEIEAKEKMFQEA
QQLLKEEKEALVAMGIDRSSLTSLETSYFTPQKRKLFGNKKRKSFFLRESGKGQPPGSDS
DEDSQKKPQLLEQTKRLSQNLSLDHFDEHRDPLQRQRALSAVSILTITMKEQEKSQEPCL
PCGENLASKYLVWNCCPLWLCIKKVLRTVMTDPFTELAITICIIINTVFLAMEHHKMEAS
FEKMLNTGNLVFTSIFIAEMCLKIIALDPYHYFRRGWNIFDSIVALLSFADVMNIFQKRS
WPFLRSFRVLRVFKLAKSWPTLNTLIKIIGNSVGALGSLTVVLVIVIFIFSVVGMQLFGH
SFNSQKSAKLCNPTGPTVSCLRHWHMGDFWHSFLVVFRILCGEWIENMWECMQEANASSS
LCVIVFILITVIGKLVVLNLFIALLLNSFSNEERNGNLEGQARKTKVQLALDRFRRAFCF
VRHTLEHFCHKWCRKQKLPKQKEVTGGCAAQSKDIIPLVTEMKRGSETQEELGILTSVPK
TLGIRHDRTWLAPLAEEEDDAEFSGEDNAQPITQPEAEQQKSDVTSILSECSTIDLQDGF
GLLPEMVPEKQPERCLPKGFGCCFPCCSMDKRKPHWVIWWNLRKTCYQIVKHSWFESFII
FVILLSSGALIFEDVYLKDRPKIQELLNCTDIIFTYVFILEMVLKWVAFGFGKYFTSAWC
CLDFIIVIVSVTTLINLKELKSFRTLRALRPLRALSQFEGMKVVVNALIGAIPAILNVLL
VCLIFWLIFCILGVHFFSGKFGKCINGTESVISYTIIANKSQCESGNFSWINQKVNFDNV
GNAYLALLQVATFKGWMDIIYAAVDSREKEQQPKFESNSLGYIYFVVFIVFGSFFTLNLF
IGVIIDNFNQQQKKISGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKCQGLVFDVV
TSQIFDIIIISLIILNMISMMAESYDQSKAVKSTLDHLNWVFVVIFTLECLIKIFALRQY
YFTNGWNLFDSVVVLISIVSTMISTLESQEYIPFPPTLFRIVRLARIGRILRLVRAARGI
RTLLFALMMSLPSLFNIGLLLFLIMFIYAILGMNWFSKVNPGSGIDDIFNFETFAGSMLC
LFQISTSAGWDSLLSPMLRSKESCNSSSENCHLPGIATSYFVSYIIISFLIVVNMYIAVI
LENFNTATEESEDPLGEDDFDIFYEVWEKFDPEATQFIEYSALSDFADALPEPLRVAKPN
KYQFLVMDLPMVSGDRLHCMDILFAFTARVLGGSDGLDSMKAMMEEKFMETNPLKKLYEP
IVTTTKRKEEERCAAVIQKAFRKYMMKVTKGDQGDQSDLENRPHSPLQTLCNGDLPSFGV
VKGKVHYD
Download sequence
Identical sequences ENSMMUP00000038967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]