SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039110 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039110
Domain Number 1 Region: 3-373
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.24e-122
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039110   Gene: ENSMMUG00000012472   Transcript: ENSMMUT00000046069
Sequence length 518
Comment pep:known_by_projection chromosome:MMUL_1:15:77660120:77789257:1 gene:ENSMMUG00000012472 transcript:ENSMMUT00000046069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTASSAIKGAIQLGIGYTVGNLTSKPERDVLMQDFYVVESVFLPSEGSNLTPAHHYPDFR
FKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNPGASGSLFFVTSDDEFIIKTVQH
KEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCMQSGGINIRIVVMNNVLPRSMRMHFTY
DLKGSTYKRRASRKEREKSNPTFKDLDFLQDMHEGLYFDTETYNALMKTLQRDCRVLESF
KIMDYSLLLGIHFLDHSLKEKEEETSQNVPDAKRPGMQKVLYSTAMESIQGPGKSGDGII
TENPDTMGGIPAKSHRGEKLLLFMGIIDILQSYRLMKKLEHSWKALVYDGDTVSVHRPSF
YADRFLKFMNSRVFKKIQALKASPSKKRCNSIAALKATSQEIVSSISQEWKDEKRDLLTE
GQSFSSLDEEALGSRHRPDLVPSTPSLFEAASLATTISSSSLYVNEHYPHDRPTLYSNSK
GLPSSSTFTLEEGTIYLTTEPNTLEVQDDNASVLDVYL
Download sequence
Identical sequences ENSMMUP00000039110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]