SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040008 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040008
Domain Number 1 Region: 228-327
Classification Level Classification E-value
Superfamily Fibronectin type III 4.72e-22
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 2 Region: 427-530
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000315
Family Fibronectin type III 0.0068
Further Details:      
 
Domain Number 3 Region: 730-819
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000011
Family Fibronectin type III 0.01
Further Details:      
 
Domain Number 4 Region: 567-630
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000183
Family Fibronectin type III 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000040008
Domain Number - Region: 656-725
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000292
Family Fibronectin type III 0.0084
Further Details:      
 
Domain Number - Region: 339-415
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0114
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040008   Gene: ENSMMUG00000003265   Transcript: ENSMMUT00000046978
Sequence length 1194
Comment pep:known chromosome:MMUL_1:1:68338957:68408260:1 gene:ENSMMUG00000003265 transcript:ENSMMUT00000046978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MICQKFCVVLLHWEFICVITAFNLSYPITPWRFKLSCMPPNSTYDYFLLPAGLSKNTSNL
NGHYETAVEFNSSDTHFSNLSKTTFHCCFRSEQDRNCSLCADNIEGKTFVSTVNSSVFPQ
MGANWNIQCWLKGDLKLFICYVESLFKNPFKNYKHKVHLLYVLPEVLEDSPLVPQKGSFQ
MVHCNCSVHERCECLVPVPTAKLNDTLLMCLKITSGGVIFQSPLMSVQPINMVKPDPPLG
LRMEITDDGNLKISWSSPPLVPFPLQYEVKYSENSTTVIREADKIVSATSLLVDGILPGS
SYEVQVRGKRLDGPGIWSDWSTPHVFTTQDVIYFPPKILTSVGSNVSFHCIYKNENKIVS
SKKIVWWMNLAEKIPQSQYDVVSDHVSKVTFFNLNETKPRGKFTYDAVYCCNEHECHHRY
AELYVIDVNINISCETDGHLTKMTCRWSTNTIQSLAGSTLQLRYRRSSLYCFDIPSIHPI
SKPKDCYLQSDGFYECVFQPIFLLSGYTMWIRINHPLGSLDSPPTCVLPDSVGMSSCVVS
SFVFNVIFCHFLITLDFEKKIVPDMMFVFNIRYLKTKTKLGFSMYDVYDAKSKSVSLPVP
DFCAVYAVQVRCKRSDGLGLWSNWSNPAYTVVMDIKVPMRGPEFWRIINGDTMKKEKNVT
LLWKPLMKNDSLCSVQRYVINHHTSCNGTWSEDVGNHTKFTFLWTEQAHTVTVLAINSIG
ASVANFNLTFWPMSKVNIVQSLSAYPLNSSCVILSWILSPSDYKLMYFIIEWKNLNEDGE
IKWLRISSSVKKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDNTEKHQNDAGL
YVIVPVIISSSILLLGTLLILHQRMKKLFWEDVPNPKNCSWAQGLNFQKIRGFVMLPRLV
LNSQAQVIHPPRPPKVLELQPETFEHLFIKHTASVTCGPLLLEPETISEDISVDTSWKNK
DEMVPTTVVSLLSTTDLEKGSVCISDQFNSVNFSEAEGTEVTCEDESQRQPFVKYATLIS
NSKPSETDEEQGLINSSVTKCFSSKNSPLKDSFSNSSWEVEAQAFFILSDQRPNIILPHL
TFSEGLDELLRLEGNFPEENNDEKSIYYLGVTSIKKRESGVLLTDKSRVLCPFPAPCLFT
DIRVLQDSCSHFVENNFNLGTSSKKTFASYMPQFQTCSTQTHKIMENKMCDLTV
Download sequence
Identical sequences ENSMMUP00000004351 ENSMMUP00000040008 9544.ENSMMUP00000040008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]