SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040152 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040152
Domain Number 1 Region: 2-237
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-52
Family YWTD domain 0.0000000394
Further Details:      
 
Domain Number 2 Region: 248-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000716
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040152   Gene: ENSMMUG00000007612   Transcript: ENSMMUT00000047127
Sequence length 456
Comment pep:known_by_projection chromosome:MMUL_1:1:56126127:56205874:-1 gene:ENSMMUG00000007612 transcript:ENSMMUT00000047127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKNVVALDVEVATNRIYWCDLSYRKIYSAYMDKASDPKEQEVLIDEQLHSPEGLAVDWV
HKHIYWTDSGNKTISVATVDGGRRCTLFSRNLSEPRAIAVDPLQGFMYWSDWGNQAKIEK
SGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFSGGNRKMLISSTDF
LSHPFGIAVFEDKVFWTDLENEAIFSANRLNGLEISILAENLNNPHDIVIFHELKQPRAA
DACKLSVQPNGGCEYLCLPAPQISSHSPKYTCACPDTMWLGPDMKRCYRAPQSTSTTTLP
STTRTGPASTGAPGTTVHRSTDQNHSTETPNLAAAVPSSVSVPRAPSISLSTLSPATSNH
SQHYGNEDSKMGSTVTAAVIGIIVPIVVIALLCMSGYLIWRNWKRKNTKSMNFDNPVYRK
TTEEEDEDELHIGRTAQIGHVYPARVALSLEDDGLP
Download sequence
Identical sequences ENSMMUP00000040152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]