SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040415 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000040415
Domain Number - Region: 45-90
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.00209
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040415   Gene: ENSMMUG00000010135   Transcript: ENSMMUT00000020380
Sequence length 103
Comment pep:known chromosome:MMUL_1:1:41724534:41734529:-1 gene:ENSMMUG00000010135 transcript:ENSMMUT00000020380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENP
EIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Download sequence
Identical sequences A0A0D9S7Q0 A0A2K6U5Y7 F7GS32 G7NUB6 H0XJ67 H2PYQ5 Q99417
ENSP00000380702 ENSPTRP00000000986 ENSOGAP00000016157 ENSGGOP00000005689 ENSOGAP00000016157 ENSP00000380702 9606.ENSP00000380702 GO.33777 gi|57242777|ref|NP_036465.2| NP_036465.2.87134 NP_036465.2.92137 XP_003415559.1.64505 XP_003799049.2.62490 XP_004371974.1.4749 XP_008149382.1.99482 XP_010344754.1.74449 ENSMMUP00000040415 ENSPTRP00000000986 ENSP00000380702 ENSGGOP00000005689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]