SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040802 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040802
Domain Number 1 Region: 255-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 2 Region: 213-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.67e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 296-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-20
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 4 Region: 47-98
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-17
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 5 Region: 1-43
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0000000000687
Family SCAN domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040802   Gene: ENSMMUG00000018717   Transcript: ENSMMUT00000047776
Sequence length 353
Comment pep:known_by_projection chromosome:MMUL_1:X:133548594:133557758:-1 gene:ENSMMUG00000018717 transcript:ENSMMUT00000047776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVLEQFLSILPKETQNWVQKHHPQNVKQALVLVEFLQREPDGTKNESLLTFEDVAVYFS
EEEWQLLDPPEKTLYNDVMQDIYETVISLEAFIQTHPFKIIIQVNINKRPFLEINPKFRT
DIGKYKTGLKLKNDTGNDHPISVSTSEIQTSGCKVSKKTRMKIAQKTMGRENPGDTHSVQ
KWHRAFPRKKRKKLATCKQEVPKLMDLHGKGPTGEKPFKCQECGKSFRVSSDLIKHQRIH
TGEKPYKCQQCDKRFRWSSDLNKHFMTHQGIKPYRCSWCGKSFSHNTNLHTHQRIHTGEK
PFKCDECGKRFIQNSHLIKHQRTHTGEQPYTCSICKRNFSRRSSLLRHQKLHR
Download sequence
Identical sequences ENSMMUP00000040802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]