SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040961 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040961
Domain Number 1 Region: 103-238
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.41e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.000000258
Further Details:      
 
Domain Number 2 Region: 11-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.66e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.00000818
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040961   Gene: ENSMMUG00000032415   Transcript: ENSMMUT00000047928
Sequence length 241
Comment pep:novel chromosome:MMUL_1:X:77977454:77978179:1 gene:ENSMMUG00000032415 transcript:ENSMMUT00000047928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGESARSLGKGSAPPGPVPEGSIRVYSMRFCLFAERTRLVLKAKGIRHELISINLKNKP
EWFFKKNPFGLVPVLENSQDQLICESPITCEYLDEAYPGKKLLPDDSYEKACQKMILELF
SKLSSLVRSFIRSQNKEDYAGLKEEFRKEFTELEEVLSNKKTMFFGDNSLSMIDYLIWPW
FERLEAMRLYECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNCPEACDYG
L
Download sequence
Identical sequences F6UJ19
9544.ENSMMUP00000040961 ENSMMUP00000040961 ENSMMUP00000040961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]